SoyBooru
AccountPostsCommentsHelpSystemTagsSoyBooru Guidesoyjak.party
Blotter updated: 02/13/26 Show/Hide Show All
  • 02/13/26 - How it works, controversial sorting: Posts are ranked by Total Activity (most votes) once they reach a 5-vote minimum. To qualify as "Controversial," a post must have a split between 45% and 65% for either Upvotes or Downvotes.
  • 02/13/26 -
    ★

    (You) need to save our The Democracy. (You)r votes are now more powerful.

    ★
  • 02/11/26 - DID YOU KNOW THAT: white_background, transparent_background, drawn_background, irl_background etc are good tags?
  • 02/05/26 - Reporting now uses a drop-down menu instead of a blank field. Please familiarize yourself with it.
  • 02/02/26 - Approvers: Mentioning rule-breaking posts in the approval queue instead of silently letting them get deleted is grounds for a demotion.
Navigation
Prev | Index | Next

IP 216.73.216.180 has been banned until the end of time because of VPN Detected

If you couldn't possibly be guilty of what you're banned for, the person we banned probably had a dynamic IP address and so do you. Please email mustard@soyjak.st or post in the /q/ thread.

See http://whatismyipaddress.com/dynamic-static for more information.

Contact the staff (be sure to include this message)

161565: looking_at_you mustache nose nostril nostrils pencil_mustache sonic.exe sonic_the_hedgehog teeth teeth_showing variant:sidson wrinkles
looking_at_you mustache nose nostril nostrils pencil_mustache sonic.exe sonic_the_hedgehog teeth teeth_showing variant:sidson wrinkles // 320x240 // 14.5KB
avatar xerox January 12, 2026; 23:50 - Reply
ononono is dat a domain
77451: brown_skin ear fez lips meta:tagme morocco nas:amerimutt teeth
brown_skin ear fez lips meta:tagme morocco nas:amerimutt teeth // 2050x2732 // 2.1MB
avatar Gringoslayer1488 July 14, 2024; 18:00 - Reply
Vnbothered gem
avatar Chud1 July 14, 2024; 18:08 - Reply
NAS format but is hating on MOORoccoans therefore Iron
avatar Chud2 July 15, 2024; 00:54 - Reply
@Chud: they do look like demons irl
avatar emerald January 12, 2026; 23:43 - Reply
Gem
avatar JimboClittyLeakageArchive January 12, 2026; 23:44 - Reply
jimbrap
155270: brown_skin jimbo_(namefag) jimbo_(user) jimbrap jimbraphog meta:ai_generated meta:namefags meta:revjak oneshot oneshot_pedo_nigger oneshotfag pooneshit pooneshit_pedo series:the_many_faces_of_jimbrap speech_bubble speech_bubble_empty variant:ukmutt vivo_endive
brown_skin jimbo_(namefag) jimbo_(user) jimbrap jimbraphog meta:ai_generated meta:namefags meta:revjak oneshot oneshot_pedo_nigger oneshotfag pooneshit pooneshit_pedo series:the_many_faces_of_jimbrap speech_bubble speech_bubble_empty variant:ukmutt vivo_endive // 1024x1024 // 1.4MB

showing 10 of 16 comments

avatar retard December 26, 2025; 20:57 - Reply
@Thub: irtrvkebrim
avatar SchizUrabe December 26, 2025; 21:02 - Reply
Mexican jimbo
avatar Pico December 26, 2025; 21:03 - Reply
@SchizUrabe: you could just say ecstasy
avatar Chud December 26, 2025; 21:17 - Reply
this will be jimbo in 2026
avatar Chud December 26, 2025; 21:37 - Reply
live morostein reaction
avatar trevor December 26, 2025; 21:38 - Reply
@Chud: obsessed with him
avatar Chud December 26, 2025; 21:59 - Reply
avatar Vergilius January 12, 2026; 23:35 - Reply
haha I love this
avatar Chud January 12, 2026; 23:36 - Reply
diddyblud above me
avatar Vergilius January 12, 2026; 23:41 - Reply
@Chud: fuck you
160599: closed_eyes crying glasses open_mouth pointing rubber stubble tear transparent_background variant:reaction_soyjak variant:soyjak_neo
closed_eyes crying glasses open_mouth pointing rubber stubble tear transparent_background variant:reaction_soyjak variant:soyjak_neo // 686x386 // 65.7KB
avatar Chud1 January 9, 2026; 21:38 - Reply
Gem
avatar Coemskong January 9, 2026; 21:47 - Reply
Gem
avatar H3K January 11, 2026; 17:37 - Reply
Gem.
avatar Nobody1 January 11, 2026; 17:40 - Reply
Gem
avatar Virilis January 12, 2026; 23:17 - Reply
Gem
avatar Chud2 January 12, 2026; 23:38 - Reply
Coal
92060: 2soyjaks award beheaded blood decapitation heart its_over love murder obsessed text variant:bernd variant:soyak yandere
2soyjaks award beheaded blood decapitation heart its_over love murder obsessed text variant:bernd variant:soyak yandere // 1373x1500 // 326.1KB
avatar Chud1 December 9, 2024; 18:55 - Reply
Us yandere fans are White lol
avatar GemersonLakeAndPalmer December 9, 2024; 19:01 - Reply
>Oh my Nippon, senpai existed in the presence of another woman, I need to kill the love of my life now or something
avatar Chud2 January 12, 2026; 23:37 - Reply
marge Yanderes would not kill their Senpai
122364: a_center_for_autism autism gigachad hair meta:ai_generated meta:not_oc nas:gigachad nazi_flag nazism
a_center_for_autism autism gigachad hair meta:ai_generated meta:not_oc nas:gigachad nazi_flag nazism // 940x784 // 789.1KB

showing 10 of 22 comments

avatar Chud June 11, 2025; 13:58 - Reply
@Chud:>what if i raped myself and teleported to my birth day and raped myself in my moms tummy ai_but_not_completely_ai_doe amerimutt looking_to_the_left mcdonalds mutt open_mouth pink_skin remastered soyjak stubble subvariant:impish_amerimutt teeth upscaled variant:impish_soyak_ears
avatar H3K June 11, 2025; 14:03 - Reply
@Chud: I'm talking about the ones that haven't repented and accepted the Gospel. I know that not gooning doesn't make a person Christian, I know it's about what you believe, and I believe the Christian worldview to be the correct worldview. The existence of God, the divinity of Christ, the Resurrection, the Trinity, I believe all of it.
avatar Chud June 11, 2025; 16:36 - Reply
@H3K: you meant those who believe in judaism or just greedy people?
avatar Soob1234 June 12, 2025; 19:38 - Reply
@Chud: noontypical projection
avatar Chud June 13, 2025; 12:54 - Reply
@Chud:
>what if i raped myself and teleported to my birth day and raped myself in my moms tummy
artist:bulgarian brown_skin clothes dark discord discord_logo_facial_mark esl facial_mark fnf_pedo fnfpedo friday_night_funkin' glasses hair hat map_(pedophile) ominous open_mouth pedophile smile stinky stubble subvariant:chudplier text variant:chudjak variant:markiplier_soyjak yellow_eyes
avatar Chud July 11, 2025; 07:03 - Reply
@Chud: trvth about autismnoons
avatar JimboClittyLeakageArchive December 16, 2025; 00:57 - Reply
>AUTISM = GIGA

avatar jimbo December 16, 2025; 00:58 - Reply
@JimboClittyLeakageArchive: stop posting your fetish bub
avatar MoistPepper December 16, 2025; 00:58 - Reply
@JimboClittyLeakageArchive: ew she's not like this
avatar Chud January 12, 2026; 23:35 - Reply
@H3K: can confirm
161547: big_mouth brown_skin gape jimbo_(namefag) meta:namefags oneshot variant:alicia yellow_teeth
big_mouth brown_skin gape jimbo_(namefag) meta:namefags oneshot variant:alicia yellow_teeth // 1512x2933 // 564.2KB
avatar Chud1 January 12, 2026; 21:20 - Reply
oc btw forgot to put
avatar JimboClittyLeakageArchive January 12, 2026; 21:23 - Reply
tanzanite
avatar sackz2 January 12, 2026; 23:24 - Reply
geg he really does look like this
117959: 2026 beard bible bible_verse christ christcuck christianity gemersonlakeandpalmer_(user) glasses god grey_eyes grey_hair hair jesus jesus_christ long_hair open_mouth parody soyjak text variant:feraljak wordswordswords you_will
2026 beard bible bible_verse christ christcuck christianity gemersonlakeandpalmer_(user) glasses god grey_eyes grey_hair hair jesus jesus_christ long_hair open_mouth parody soyjak text variant:feraljak wordswordswords you_will // 1858x2664 // 549.2KB

showing 10 of 29 comments

avatar Chud May 20, 2025; 23:20 - Reply
@Mick-:
avatar Mick- May 20, 2025; 23:21 - Reply
@Chud: mindbroken by me
avatar Chud May 20, 2025; 23:24 - Reply
@Mick-: mindbroken by god not letting you be a sodomite flamboyant person
avatar KeKino May 20, 2025; 23:33 - Reply
@Chud:
agnostic agnosticism atheism autobot brown_skin colorlesspy(nameroach) flag:italy flag:liberia flag:palestine flag:turkiye flag:ukraine fundamental_paper_education invincible_(show) italy kaaatie liberia meta:revjak metal_gear_rising omni_man palestine_flag shitskin stink_lines stinky subvariant:mexiaryan t50_eyes transformers trend:slopjak turkiye turkroach ukrainian_flag variant:meximutt
avatar Chud May 20, 2025; 23:37 - Reply
@ToonSoy: Who even is this noon i dont pay attention to soybooru nameflamboyant persons
avatar jewishautismaward78 June 1, 2025; 23:29 - Reply
>THESE CHRISTchadS ARE OBSESSED WITH MEEEEEEEEEEEEEEEEEE
avatar Mick- June 1, 2025; 23:39 - Reply
THESE CHRISTchadS ARE OBSESSED WITH MEEEEEEEEEEEEEEEEEE
chad giga_chad gigachad grey_skin nas:gigachad smile subnas:gigabud subnas:gigamonkey
avatar Soyberg_Jakson January 1, 2026; 23:42 - Reply
bait
avatar Chud January 12, 2026; 23:22 - Reply
atheist coal
avatar trevor January 12, 2026; 23:23 - Reply
@Chud: Trvke.
146766: ack artist:crimsonvoidhydra1488 autism autismwaffen award bloodshot_eyes crying distorted glasses hello_my_name_is_(sticker) meta:namefags rope speech_bubble speech_bubble_empty subvariant:jartycuck subvariant:patrick suicide transparent_background trend:slopjak trevor_(user) variant:chudjak
ack artist:crimsonvoidhydra1488 autism autismwaffen award bloodshot_eyes crying distorted glasses hello_my_name_is_(sticker) meta:namefags rope speech_bubble speech_bubble_empty subvariant:jartycuck subvariant:patrick suicide transparent_background trend:slopjak trevor_(user) variant:chudjak // 2750x2000 // 1.0MB
avatar Pico November 23, 2025; 23:55 - Reply
disgusting trevorcreature
avatar trevor November 24, 2025; 00:00 - Reply
@Pico: fnf diddy
avatar Chud1 November 24, 2025; 11:08 - Reply
@trevor: ack artist:crimsonvoidhydra1488 autism autismwaffen award bloodshot_eyes crying distorted glasses hello_my_name_is_(sticker) meta:namefags rope speech_bubble speech_bubble_empty subvariant:jartycuck subvariant:patrick suicide transparent_background trend:slopjak trevor_(user) variant:chudjak
avatar Chud2 November 26, 2025; 01:34 - Reply
gemmy
avatar JimboClittyLeakageArchive January 12, 2026; 23:22 - Reply
jimbrap
avatar trevor January 12, 2026; 23:22 - Reply
@Chud: ^ Brap.
124802: angry beard big_lips black_skin eyebrows glasses nigger open_mouth series:cobson_brothers shrek subvariant:ogreson transparent_background variant:cobson yellow_sclera
angry beard big_lips black_skin eyebrows glasses nigger open_mouth series:cobson_brothers shrek subvariant:ogreson transparent_background variant:cobson yellow_sclera // 872x737 // 31.1KB
avatar hairynigga468 June 26, 2025; 04:20 - Reply
I aint gon hold you this lowkey look like Twitxx
avatar Chud1 June 26, 2025; 08:19 - Reply
antiswarthy
avatar Chud2 June 26, 2025; 18:09 - Reply
Warrior 'p
avatar niggistraper June 28, 2025; 14:18 - Reply
jimbrap
avatar trevor November 26, 2025; 04:05 - Reply
avatar Chud3 November 26, 2025; 04:29 - Reply
ack artist:crimsonvoidhydra1488 autism autismwaffen award bloodshot_eyes crying distorted glasses hello_my_name_is_(sticker) meta:namefags rope speech_bubble speech_bubble_empty subvariant:jartycuck subvariant:patrick suicide transparent_background trend:slopjak trevor_(user) variant:chudjak
avatar JimboClittyLeakageArchive January 12, 2026; 23:22 - Reply
jimbrap
avatar trevor January 12, 2026; 23:22 - Reply
@Chud: ^ Brap.
88951: 1899 1911 2soyjaks arthur_morgan beige_shirt blue_eyes blue_shirt brown_eyes brown_hair clothes collar cowboy friendship game gunslinger hat john_marston looking_at_you no_more_brother_wars outlaw pocket red_dead_redemption red_dead_redemption_2 rockstar_games scar variant:cobson variant:feraljak vest video_game white_skin yellow_hair
1899 1911 2soyjaks arthur_morgan beige_shirt blue_eyes blue_shirt brown_eyes brown_hair clothes collar cowboy friendship game gunslinger hat john_marston looking_at_you no_more_brother_wars outlaw pocket red_dead_redemption red_dead_redemption_2 rockstar_games scar variant:cobson variant:feraljak vest video_game white_skin yellow_hair // 1920x1080 // 220.6KB
avatar Chud1 November 12, 2024; 05:59 - Reply
RDRWABAG
avatar BigBlackNigger November 15, 2024; 16:49 - Reply
Gemmy
avatar Chud2 February 18, 2025; 15:12 - Reply
gem
avatar Johnmarstonirl January 12, 2026; 23:21 - Reply
Me
161436: clothes its_over meta:namefags meta:not_oc moistpepper_(user) number red_skin scoreboard stubble subvariant:massjak subvariant:massmeowjak suit text variant:gapejak variant:impish_soyak_ears winner_(chirp)
clothes its_over meta:namefags meta:not_oc moistpepper_(user) number red_skin scoreboard stubble subvariant:massjak subvariant:massmeowjak suit text variant:gapejak variant:impish_soyak_ears winner_(chirp) // 904x682 // 161.9KB

showing 10 of 29 comments

avatar NotaSoyak January 12, 2026; 15:28 - Reply
>winner

>lost

Oh the irony!
avatar SteamEngine January 12, 2026; 16:07 - Reply
COBBLESTONE'S A FUCKING MASTER, MOISTPEPPER'S A FUCKING AMATEUR. COBBLESTONE'S GOT THE SKILLS, MOISTPEPPER'S JUST A FUCKING TRYHARD. COBBLESTONE'S A FUCKING LEGEND, MOISTPEPPER'S A FUCKING MEME. COBBLESTONE'S A FUCKING GOD, MOISTPEPPER'S A FUCKING CHUD. COBBLESTONE'S GOT THE POON, MOISTPEPPER'S GOT THE FUCKING DUST. COBBLESTONE'S A FUCKING BEAST, MOISTPEPPER'S A FUCKING BITCH.
avatar Swatted January 12, 2026; 16:08 - Reply
What does this even mean
avatar Juaco January 12, 2026; 16:25 - Reply
rule of thought: don't kiss yourself over someone on the internet who doesn't even recognize you
avatar MenstrualCykill January 12, 2026; 16:27 - Reply
@Swatted: Some dude killed himself at the thought he won't ever get to date MoistPepper
avatar Swatted January 12, 2026; 16:28 - Reply
@MenstrualCykill: So forced it hurts
avatar XX_IwajuGoyim_XX January 12, 2026; 23:00 - Reply
from personal experience it's fucking horrifying to try to ack yourself by overdosing so at least he's in a better place now
avatar XX_IwajuGoyim_XX January 12, 2026; 23:01 - Reply
@BestKnownForCoal: first ferret in the history of the 'sharty to ever kill himself over a snca nameflamboyant person
avatar XX_IwajuGoyim_XX January 12, 2026; 23:01 - Reply
@BestKnownForCoal: first ferret in the history of the 'sharty to ever kill himself over a snca nameflamboyant person
avatar XX_IwajuGoyim_XX January 12, 2026; 23:01 - Reply
accidentally posted it again award
161548: antenna cockroach country flag flag:kurdistan glasses hanging kurd kurdistan noose open_mouth roach roachnigger rope soyjak stubble suicide sun tongue tongue_out variant:feraljak white_background
antenna cockroach country flag flag:kurdistan glasses hanging kurd kurdistan noose open_mouth roach roachnigger rope soyjak stubble suicide sun tongue tongue_out variant:feraljak white_background // 1500x1354 // 99.1KB

showing 10 of 27 comments

avatar MenstrualCykill January 12, 2026; 22:43 - Reply
@emerald: ^ has an erectile dysfunction
avatar emerald January 12, 2026; 22:46 - Reply
@MenstrualCykill:
>has an

esl
avatar Dunchenman January 12, 2026; 22:48 - Reply
@emerald: yo crakka boi where's my drawing with my wyf mayne
avatar MenstrualCykill January 12, 2026; 22:51 - Reply
@MenstrualCykill:
speech
garten_of_banban octopus open_mouth orange_skin soyjak stinger_flynn variant:stinger_flynnjak
avatar emerald January 12, 2026; 22:52 - Reply
@Dunchenman: i forgot or something
avatar MenstrualCykill January 12, 2026; 22:52 - Reply
fuck I'm dumb
avatar emerald January 12, 2026; 22:53 - Reply
Ill try to remember tommorow
avatar emerald January 12, 2026; 22:53 - Reply
@MenstrualCykill: stage 5 special
avatar MenstrualCykill January 12, 2026; 22:54 - Reply
@emerald: speech
garten_of_banban octopus open_mouth orange_skin soyjak stinger_flynn variant:stinger_flynnjak
avatar emerald January 12, 2026; 22:56 - Reply
@MenstrualCykill: finally figured out how to reply to the right person award
161541: background beard black_and_white family_guy glasses knife meta:not_oc nobody_cares nophono stubble text variant:peterlöwenbräugriffinakajustinpetergriffinfromthehittelevisionshowfamilyguythatwasmadebysethmacfarlaneakapetergriffinsoyjakforshortjak variant:unknown
background beard black_and_white family_guy glasses knife meta:not_oc nobody_cares nophono stubble text variant:peterlöwenbräugriffinakajustinpetergriffinfromthehittelevisionshowfamilyguythatwasmadebysethmacfarlaneakapetergriffinsoyjakforshortjak variant:unknown // 1357x758 // 61.5KB

showing 10 of 18 comments

avatar OrHoweverTheBurgerIsEaten January 12, 2026; 21:16 - Reply
peterlowenbraugriffinakajustinpetergriffinfromthehittelevisionshowfamilyguythatwasmadebysethmacfarlaneakapetergriffinsoyjakforshortjak WQN
avatar Yohannen January 12, 2026; 21:17 - Reply
>justin peter griffin

We've got a family guy expert here
avatar Yohannen January 12, 2026; 21:17 - Reply
@OdessanBvll: ongezellig is coal and unfunny
avatar Chud January 12, 2026; 21:19 - Reply
@oscari: listened to the whole thing /calm/erald
avatar Chud January 12, 2026; 21:20 - Reply
@oscari: kiss yourself zoophile noon
avatar OdessanBvll January 12, 2026; 21:22 - Reply
@Yohannen:
SNCANVKE:
This is my last post, fuck this homosexual site and fuck the soysphere
This video is a WIP of a full on recreation i was making, i had already wrote lyrics for it and made a storyboard somewhat. Doll had also agreed to voice it so, if hes reading this, i apologize for wasting your time. The copium tank has run out today and i had nothing to hide the fact this site is full of flamboyant people, ugly persons and gentiles that arent worth my time. Entertaining a bunch of LITERAL flamboyant people on the "make fun of bald feminine men" website (i still cant believe thats right) does not honor God and i have completely wasted my time by making this or any previous OC. Theres no purpose to making these specialed animations other than to waste my time, and i fucking hate the main site and it deserves to wither out already. Quote should just shut it down already, the frog posters were always right. This site is the best example of flanderization and group think i have ever seen, which each generation of nusois culture gets passed down EXACTLY like the telephone game, losing integrity and being watered down until it means nothing anymore and its completely unfunny. This is why it has become a generic raisinposting website with no aim whatsoever, and why NOPHONO cares about 'jakking anymore. Mark my words, MARK THEM, in the span of the next year or so, this website will become reddit 2, and mods will try to "steer away from soyaks" or some other homosexual raisin because its a "dead meme". The last days of the sharty will be a bunch of pissbaby chudcels and flamboyant people raisinposting completely unrelated raisin to 'jaks, and then it will become a DNB and be forgotten. The general response to this comment will prove my point, because it will be something along the lines of "Why do you care so much/its not that serious", nobody takes this site serious or cares about it, its just the nu "imageboard where i post the stuff i stim over and talk to people" because 4chad is too diddyphilic and rulechaded to fulfill that role anymore. This is just a place for specials to use for a while, then move on, like a revolving door of sorts. Nobody makes any variants anymore, and what proves my point even further is that the only people that do dont do it for the purpose of 'jakking, they do it so they dont get an offtopic ban while forcing their toddlerslop/specialslop. Seriously, i cant even fucking count the ammount of "reverse lees" i've seen already that are just some autist forcing everyone to look at their specialed trace of something they like but with a beard and glasses. Theres a new one every 2 or 3 weeks, the last one was the storybots diddy and now its some noon forcing childrens show #64647 about snca i dont remember. This also goes for fpe and zellig flamboyant people, although i think the two are very different. You can clearly tell zellig flamboyant people actually like their dumb raisin and are passionate about it, not only by the way they spread it but by the way they talk about it. They also try to make OC about it, which is something Fdiddys dont do at all. Still, zellignoons are either extremely homosexual teenagers or actual diddys, and their shilling is annoying and unjustified. Fdiddys though? every dumb nusoi will tell me to take my meds in fear of being portrayed as fat and black, but i dont think they actually like FPE. Its very obvious that FPE is just a mask/tool they use to do their trolling and nothing else, they clearly dont give a raisin about it and, if FPE became illegal to post on the internet for some reason, they would immediately jump to another ugly personslop to force and discard FPE like it never existed.
>DERES A CORD MAYNE


No i dont think there is a cord or 'gram or whatever, i just think they are annoying children that love to attentionwhore by annoying everyphono
Also fuck the 'ru too.
avatar oscari January 12, 2026; 21:24 - Reply
@Chud:
https://vocaroo.com/1lDObPppACnv
avatar Chud January 12, 2026; 21:26 - Reply
@Chud: yeah.... nobody asked.....
avatar PRIZINS January 12, 2026; 21:27 - Reply
@oscari: stop recording in your basement
avatar SoyGuy62 January 12, 2026; 22:50 - Reply
IAS in Jakarta
95351: adolf_hitler anime anime_female brenton_tarrant classroom closed_mouth doki_doki_literature_club drawing female full_body glasses glitch hair hair_ribbon hand long_hair monika monitor room smile smug soyjak surprised tab uniform variant:chudjak weapon window
adolf_hitler anime anime_female brenton_tarrant classroom closed_mouth doki_doki_literature_club drawing female full_body glasses glitch hair hair_ribbon hand long_hair monika monitor room smile smug soyjak surprised tab uniform variant:chudjak weapon window // 4096x1844 // 7.3MB

showing 10 of 35 comments

avatar Chud January 6, 2025; 22:33 - Reply
gemmy
avatar HaterofAntichrist January 8, 2025; 17:53 - Reply
Wife
avatar Chud February 3, 2025; 19:22 - Reply
@Chud: trvke
avatar Chud March 9, 2025; 14:05 - Reply
literally me
avatar Chud March 11, 2025; 13:34 - Reply
@Chud: marge
avatar Chud April 7, 2025; 15:21 - Reply
@Slvt4BIBISI:
OHNONONONO MONIKAugly personS WHAT'S THIS?!
avatar Mick April 7, 2025; 15:24 - Reply
@Chud:
They just can't stop losing
avatar Ariane_Yeong September 28, 2025; 00:18 - Reply
Geg look at the two portraits in the background
avatar Chud September 28, 2025; 00:28 - Reply
Illusional Gem
avatar Chud January 12, 2026; 22:49 - Reply
Gemmy because of the hidden portraits
138426: amphibian bunny_ears clothes coco_(ongezellig) freckles frog hair looking_at_you mymy_(ongezellig) nas:baxter nas:pepe ongezellig pepe pepe_the_frog rabbit smile subnas:cocofrog teeth_showing
amphibian bunny_ears clothes coco_(ongezellig) freckles frog hair looking_at_you mymy_(ongezellig) nas:baxter nas:pepe ongezellig pepe pepe_the_frog rabbit smile subnas:cocofrog teeth_showing // 1018x1017 // 155.5KB
avatar Ariane_Yeong September 30, 2025; 23:40 - Reply
Goalish gem.
avatar Juaco October 3, 2025; 17:44 - Reply
ghoulish coal.
avatar OdessanBvll January 12, 2026; 22:47 - Reply
https://soyjak.st/int/thread/228541.html#q228691
QUOTE POSTED IT
36975: angry blond blood blue_eyes buff closed_mouth clothes full_body gigachad glasses hair nazism smile soyjak subvariant:chudjak_front subvariant:muscular_chud sun swastika tshirt variant:chudjak white_skin
angry blond blood blue_eyes buff closed_mouth clothes full_body gigachad glasses hair nazism smile soyjak subvariant:chudjak_front subvariant:muscular_chud sun swastika tshirt variant:chudjak white_skin // 1059x973 // 66.0KB

showing 10 of 16 comments

avatar Chud June 21, 2023; 01:43 - Reply
^ celtic antifa gemmy
avatar Chud September 9, 2023; 16:26 - Reply
NAG (Not A Gigachad)
avatar Chud June 15, 2024; 22:34 - Reply
coffin of andy and leyley peak enjoyer
avatar Chud June 15, 2024; 22:45 - Reply
i heard a massive ear drum-shattering 190db brap above me
avatar Chud June 15, 2024; 22:46 - Reply
trans-phobic nazi russophobic bigot BRAAAAAAAAAAAAPPPPPPPPPPhog who weighs 1488 kgs above me
avatar Chud June 15, 2024; 22:47 - Reply
slava ukraini
avatar Chud June 15, 2024; 22:48 - Reply
avatar Chud June 15, 2024; 22:50 - Reply
i hear a loud brap leaving two yellow churka goblin buttcheeks above me
avatar Silberfisch September 6, 2025; 21:11 - Reply
big_lips closed_mouth fat flag:nazi_germany hair morenazi mutt nazism red_lips red_shirt speech_bubble subvariant:branigger swastika ugly vantablack variant:brandon yellow_sclera
>dis ez mii o algo
avatar MrMemer January 12, 2026; 22:47 - Reply
@Silberfisch:
>
alunya anarchism anarcho-communism brown_skin cat_ear catgirl commie commie_pedo_troon commiepedotroon communism flag:anarcho-communism jimbo_(namefag) jimbo_(user) jimbrap jimbraphog leftist leftypol meta:namefags oneshot oneshot_pedo_nigger oneshotfag pooneshit pooneshit_pedo speech_bubble speech_bubble_empty variant:alicia vivo_endive
144075: how_it_feels_to_be_a_nusoi i_need_a_spaking meta:dailyjak nusoi nusoicaca nusoinigger nusoishitskin subvariant:hunky_twink_sex_machine the_sopranos tony_soprano variant:alicia video
how_it_feels_to_be_a_nusoi i_need_a_spaking meta:dailyjak nusoi nusoicaca nusoinigger nusoishitskin subvariant:hunky_twink_sex_machine the_sopranos tony_soprano variant:alicia video // 1920x1080, 12.8s // 1.8MB
avatar emerald November 10, 2025; 21:12 - Reply
gem
avatar Chud1 November 10, 2025; 21:20 - Reply
a really well made gemerald, how did you animate this?
avatar Chud2 November 11, 2025; 00:39 - Reply
kino incoming
avatar trevor November 11, 2025; 01:15 - Reply
@Chud: some sort of ai software, too jittery to be manmade
avatar greg November 15, 2025; 05:42 - Reply
clothes comic comic_sans glasses necktie scared series:soyjaks? soyjak soyjaks? speech_bubble stonetoss stubble subvariant:soyak_(concerned) text variant:soyak
avatar Metro2033 January 6, 2026; 10:47 - Reply
why is this actually tuff af
avatar LETS_BEHEAD_OURSELVE January 6, 2026; 10:59 - Reply
lovely
avatar Chud3 January 12, 2026; 22:42 - Reply
I look like this and say this
First Prev << 835 836 837 838 839 840 841 842 843 844 845 >> Next Last
Media © their respective owners, Shimmie © Shish & The Team 2007-2020, based on the Danbooru concept.
Shimmie version 2.9.2+
Contact