AccountPostsCommentsHelpSystemTagsWiki
Blotter updated: 11/08/25 Show/Hide Show All
  • 11/08/25 - namefag shitfling to the extreme
  • 10/18/25 - Simple Notice Ticker
    ⚠️ Uploads with fewer than 5 (five) tags and a variant tag WILL be denied ⚠️
  • 09/15/25 - Flagspam, countrywars, and namefag posts must now be tagged meta:flagspam meta:countrywars or meta:namefags respectively. These tags may be blacklisted by users at will. Flagspam will be blocked by default.
  • 07/07/25 - Questions, complaints, or suggestions? Send them to soysneed@soyjak.st or post in the complaint thread

IP 216.73.216.218 has been banned until the end of time because of VPN Detected

If you couldn't possibly be guilty of what you're banned for, the person we banned probably had a dynamic IP address and so do you. Please email soysneed@soyjak.st or post in the /q/ thread.

See http://whatismyipaddress.com/dynamic-static for more information.

Contact the staff (be sure to include this message)

128541: forced_meme glasses gubby holding_object holding_phone meta:tagme nigger nigger_rabbit roblox stubble twitter variant:unknown xitter zoomer
forced_meme glasses gubby holding_object holding_phone meta:tagme nigger nigger_rabbit roblox stubble twitter variant:unknown xitter zoomer // 720x903 // 95.2KB

showing 5 of 6 comments

avatar
- Reply
Juaco: got their culture 'aped by specialed flamboyant people who don't understand Roblox yet again award
- Reply
Chud: @Juaco: sharty culture also get raped by specialed flamboyant people nusois
- Reply
Chud: [h2]
GUBBY HECKIN GEM
[/h2]
- Reply
Chud:
GVBBY VVQ|\|
- Reply
Chud: two diddys above me
127023: anti_sharty blond blush boondocks caption hunky_twink_sex_machine meme meta:leaky nate nigger rosy_cheeks sharty soyjak soyjak_party the_boondocks variant:alicia
anti_sharty blond blush boondocks caption hunky_twink_sex_machine meme meta:leaky nate nigger rosy_cheeks sharty soyjak soyjak_party the_boondocks variant:alicia // 659x394 // 33.9KB

showing 5 of 13 comments

- Reply
Chud: NO FUN ALLOWED BECAUSE I SAID SO!!!!!!!!
- Reply
Chud: Typical noon
- Reply
Chud: Rusoriz looks like this
- Reply
Chud: uncle ruckus literally goes to gemmyheaven and becomes white in a dream sequence geg
- Reply
Chud: did i just catch you having fun?
133082: 2024 4soyjaks admin admins azumanga_daioh ban ban_hammer bananasplit black_background blue_eyes blue_text button button_eyes censor central_intelligence_agency clothes coal december doll doll_(user) dress froot frown glasses green_scarf green_text grey_skin grey_text hair hammer happy hat heart holding_hammer holding_object image kuz leaf meta:namefags meta:tagme moot mustache name_tag namefags nas orange_skin orange_text pink_skin purple_text quote quote_(user) red_text scarf serious smile soot soot_colors soyjak soyjak_party stitched_mouth stubble takino_tomo text tomo_takino variant:feraljak variant:gapejak variant:soyak yellow_text
2024 4soyjaks admin admins azumanga_daioh ban ban_hammer bananasplit black_background blue_eyes blue_text button button_eyes censor central_intelligence_agency clothes coal december doll doll_(user) dress froot frown glasses green_scarf green_text grey_skin grey_text hair hammer happy hat heart holding_hammer holding_object image kuz leaf meta:namefags meta:tagme moot mustache name_tag namefags nas orange_skin orange_text pink_skin purple_text quote quote_(user) red_text scarf serious smile soot soot_colors soyjak soyjak_party stitched_mouth stubble takino_tomo text tomo_takino variant:feraljak variant:gapejak variant:soyak yellow_text // 2611x1474 // 441.2KB
- Reply
Chud1: Tomo
avatar
- Reply
Scoot: schizo gem
123369: aryan blond blue_eyes brown_skin democrat hunky_twink_sex_machine nigger republican variant:cobson white_skin
aryan blond blue_eyes brown_skin democrat hunky_twink_sex_machine nigger republican variant:cobson white_skin // 828x591 // 584.0KB

showing 5 of 16 comments

- Reply
Chud: this, so much this
- Reply
DASFA: Iron
- Reply
evangelical_baptist: TRVTH
- Reply
DASFA: Post #52420
- Reply
ttt: truthful gem
132951: 3soyjaks bbc biting_lip closed_mouth dildo glasses irl meta:pornographic_content nsfw queen_of_spades spade stubble subvariant:hornyson variant:cobson
3soyjaks bbc biting_lip closed_mouth dildo glasses irl meta:pornographic_content nsfw queen_of_spades spade stubble subvariant:hornyson variant:cobson // 720x1280, 20.9s // 5.6MB

showing 5 of 11 comments

- Reply
Chud: @SpankyHamAndXandir:
Trvke I guess, I take it back
avatar
- Reply
kuzdif: gegerald
- Reply
JimboClittyLeakageArchive: Why is jimbo lifting weights (his sex toys)?
- Reply
Chud:
RACEBAIT raisinSTONE SPADEnoonS WNBAG
- Reply
ttt: @Chud: it's not a racebait, it's just spadeson and bbc
49244: bloodshot_eyes brown_skin cereal crying food glasses hanging islam map_(pedophile) muhammad open_mouth pedophile rope soyjak stubble subvariant:chudjak_front suicide text thrembos variant:chudjak yellow_teeth
bloodshot_eyes brown_skin cereal crying food glasses hanging islam map_(pedophile) muhammad open_mouth pedophile rope soyjak stubble subvariant:chudjak_front suicide text thrembos variant:chudjak yellow_teeth // 601x800 // 334.2KB
- Reply
Chud1: antiswarthy
- Reply
Chud2: hinduism is worse
79876: country meta:tagme pig pigskin pink_skin romania slavic stubble variant:meximutt
country meta:tagme pig pigskin pink_skin romania slavic stubble variant:meximutt // 888x849 // 12.1KB
- Reply
Chud1: This one is just straight up false
- Reply
Chud2: POV: you've crossed Tisa river
- Reply
Chud3:
>Slavic

>Latin country

MEDS NOW
- Reply
Chud4: @Chud: geg, tacoblimps are specialed
61346: 4chan angry anime beanie blue_eyes brown_hair cartoon chud closed_mouth ear family_guy glasses green_hair hair jake jakparty_soy mustache nate open_mouth purple_hair queen_of_spades soy soyjak soyjak_party soylent soylent_(cacao) stubble subvariant:arkansasjak tan thick_eyebrows tranny variant:chudjak variant:peterlöwenbräugriffinakajustinpetergriffinfromthehittelevisionshowfamilyguythatwasmadebysethmacfarlaneakapetergriffinsoyjakforshortjak variant:soytan variant:unknown white_skin yellow_hair yotsoyba
4chan angry anime beanie blue_eyes brown_hair cartoon chud closed_mouth ear family_guy glasses green_hair hair jake jakparty_soy mustache nate open_mouth purple_hair queen_of_spades soy soyjak soyjak_party soylent soylent_(cacao) stubble subvariant:arkansasjak tan thick_eyebrows tranny variant:chudjak variant:peterlöwenbräugriffinakajustinpetergriffinfromthehittelevisionshowfamilyguythatwasmadebysethmacfarlaneakapetergriffinsoyjakforshortjak variant:soytan variant:unknown white_skin yellow_hair yotsoyba // 1100x750 // 101.9KB

showing 5 of 32 comments

- Reply
Chud: gemmy guy
avatar
- Reply
B_B_GHAST: Family gemerald
- Reply
ImpChud: High effort tanzanite
- Reply
Chud: jartychad should be black
nate should be black and looks like htsm
- Reply
Chud: jartychad should be black
nate should be black and looks like htsm
123741: beard glasses meta:not_oc newfag phone quote screenshot sharty showing_phone soyjak_party variant:chudjak variant:unknown
beard glasses meta:not_oc newfag phone quote screenshot sharty showing_phone soyjak_party variant:chudjak variant:unknown // 1024x887 // 562.9KB
- Reply
Chud1: Why are the outlines the skin color of antiswarthy? Is this intended?
avatar
- Reply
tvrkicwvrriorforyuo: @Chud: Obsessed
- Reply
Chud2: @Chud: unbothered
avatar
- Reply
88ghost: @Chud: indifferent
133118: closed_mouth neutral subvariant:nushrimpish subvariant:shrimpish template variant:gapejak white_skin
closed_mouth neutral subvariant:nushrimpish subvariant:shrimpish template variant:gapejak white_skin // 650x720 // 16.8KB
- Reply
Chud1: weird hybrid
avatar
- Reply
H3K: @Chud: Yeah it's strange but I like it.
First Prev << 1771 1772 1773 1774 1775 1776 1777 1778 1779 1780 1781 >> Next Last